PTM Viewer PTM Viewer

AT1G18650.1

Arabidopsis thaliana [ath]

plasmodesmata callose-binding protein 3

No PTMs currently found

PLAZA: AT1G18650
Gene Family: HOM05D000020
Other Names: PDCB3

Link out to other resources with this protein ID : TAIR   |   PeptideAtlas   |   ARAPORT   |   PhosPhAt

PTMs

There are no stored PTMs for this protein

Sequence

Length: 184

MAVFVLVMILLAMAGHSSGTWCVCKEGLSEAMLQKTLDYACGAGADCGPIHQTGPCFNPNTVKSHCSYAVNSFFQKKGQSLGTCDFAGTATFSASDPSYTTCPFPASASGSGTTTPVTTTPSTRVPTTTNTRPYTITPSTGGGLGIPSGINPDYTDPSFGFKLQSPRFGFIVLFTLFLPFYLFS

Domains & Sites

Clear highlighted range 
Interpro Domains
Show IPR ID From To
IPR012946 20 104
Molecule Processing
Show Type From To
Propeptide 159 184
Signal Peptide 1 19

BLAST


Perform a BLAST search for this sequence, or a part of this sequence (minimum 50 characters)
A downloadable tutorial can be found here